Back | Reverse | Quick Reply | Post Reply |

Stump Dirtyninja or others
Link | by D-ninja on 2006-01-22 16:18:06
Try to stump me ask anything.
Have me connect anything
have me create a reference to something.
ANYTHING you name it. I'm thew Burger King of answers, have it your way.

Of knowlege that is.
or you could ask us all it's up to you.

Re: Stump Dirtyninja or others
Link | by hoheshii on 2006-01-22 16:20:25
....hehehehehe......

What's my middle name?

...hehehe....

Good luck!

Wise Man says: "Take a dog off its leash and it will wander."

Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-22 16:59:19
Your middle name is paul.
Even if it's not it is now.

Re: Stump Dirtyninja or others
Link | by ROQ sees ya. on 2006-01-22 17:10:53
lol The dirtyninja, jolly green giant burger king of answers...what a mouthful...

"Ask me anything"? Very well: What is the largest word in the english language?

Connect: The television show Distraction to dust.

Enjoy...*bow*

I had no idea engineer's middle name was Paul...my, my, how...exact...


Re: Stump Dirtyninja or others
Link | by desertranger on 2006-01-22 17:24:47
That's easy even I know that one.

OK, here's one. What are the Indian Intaglios?


Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-22 17:47:11
Roq, glad to see some real questions here.
pneumonoultramicroscopicsilicovolcanoconiosis, a type of bacterial disease found in guess what, Volcanoes.

In the show distraction they more often than not have you answer questions that if you get wrong diminsh your prize
one of these destruction options was to set off a small TNT charge under your prize
During one of these contest a contestant missed 2 questions
That contestant then proceedto turn a can of refried beans into guess what, dust.

Ranger, I almost forgot what those were, then when I thought about it I realized that they are those hudge drawings that are only visible from the air. Let me check and..... hey look at that I was right. Thank you discovery channel.

Better luck next time.
For my challenges, heh heh.
Roq, connect "a man called horse" to "white chicks", without using any other movies.

Ranger, something more up your ally.
When was the first officail air-air engagement of the f-14, month, year, location, with what, what was shot down. That should keep you busy.

Re: Stump Dirtyninja or others
Link | by Kotuso on 2006-01-22 17:48:11
Assuming there is such thing as a woodchuck and assuming it chucks wood...How much wood could a woodchuck chuck if a woodchuck could chuck wood?

The answer cannot be 42.

Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-22 17:59:17 (edited 2006-01-22 18:07:15)
~1.2lbs/hour
Averge woodchuck wieght 3lbs, assuming it's strong 40% of it's body weight for 1 hour of work. Unless it's name is Phil, lives in Punxsutawney, Lives in MY state, is over fed, gets cameras and lights shoved in its face, and is exspected to not see its shadow(Oh well no one said they were smart over in Punxsutawney). Then it hires somone else to do the work for it.

No seriously the same guys have been doing this stuff for 30 years. Talking to a ground hog, what have we done. *shakes head in shame* poor us pennslyvanians, all we have left are the Steelers and the Orange bowl. Oh and me too.

Alright Kotuso how 'bout what is the averge repsonse time for the reflex action to a sharp pain stimulous

Re: Stump Dirtyninja or others
Link | by Kotuso on 2006-01-22 18:25:23 (edited 2006-01-22 18:26:38)
Most healthy males with no nervous system disorder or mental inpairment takes around .5 seconds to .308990 seconds. If the person is unaware of course. If aware that the object or objects would induce sharp pain then the times would average from person to person judging by thier own stupidity or endurance.

Your turn,find a city with more than 5 Xs in America.

Re: Stump Dirtyninja or others
Link | by ROQ sees ya. on 2006-01-22 18:55:47
"A Man called Horse" to "White Chicks"(This movie annoyed me):

1."A Man called Horse" centers on the relations between a Native American tribe and an Englishman.
2.A common Native American symbol is the Eagle.
3.In "White Chicks", a dirty quote involving "body hair hygiene" states, in response to the question "What did you get?": "The Bald Eagle".

Yep, try this, on the topic of movies: connect the two films "Equilibrium" and "Native Son".


Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-22 19:15:50 (edited 2006-01-22 19:18:46)
I bow to your knolegeable prowless. There is no city with 5 x's in the name as I can find but there are cities like;
Yreka Zzyzx, Intercourse, Why, Greasy Corner, Parachute, Purgatory, Mianus, Yeehaw Junction, Chickasawhatchee, Climax, Enigma, Hopeulikit, Talking Rock, Good Grief, Beer Bottle Crossing, Kickapoo, Paw Paw, Roachtown, French Lick, Naked City, Diagonal, Gravity, What Cheer, Ransom, Beaver Lick, Do Stop, Monkeys Elbow, Typo, Fort Necessity, Waterproof, Dickey, Accident, Assawoman Bay, Boring, Crapo, Cockeysville, Sandwich, Embarass, Licking, Peculiar, Roach, Sleeper, Tightwad, Elmo, Square Butt, Two-Dot, Hell Hollow, Lost Nation, Sandwich Landing, Truth or Consequences, Yaphank Yonkers, Toast, Whynot, Zap, Knockemstiff, Three Legs Town, Slaughterville, Boring, Drain, Halfcom, Idiotville, Zig Zag, Uno, Virginville, Quonochontaug, Woonsocket, Due West, Ninetimes, Sugar Tit, Nameless, Only, Smartt, Yum Yum, Cut-n-Shoot, Possum Kingdom, Run and Shoot, Mosquitoville, Notown, Satans Kingdom, Goosepimple Junction, Ordinary, Kooskooskie, Lost City, Nitro, Odd, Paw, Pinch, War, Imalone, and Meeteetse.

I belive that this is the city with the most x's in it Oxoboxo River.

Roq
Native son has the word native in it
Equilibriam in the native way things want to be, or in other words things like ballance and equality.

Re: Stump Dirtyninja or others
Link | by lady_rin on 2006-01-22 21:17:03 (edited 2006-01-22 21:21:21)
Pneumonoultramicroscopicsilicovolcanoconiosis falls short by 13 letters. The word your looking for is a town in North Wales called...

Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.


There is also a train station not far from there called Gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion and a town in New Zealand called Tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu and somewhere in Thailand is a place called Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.



However Llanfair PG is the longest domain name in the world. There is also a very nice bed and breakfast there where Ranger and I stayed a few times.

Zyzzxx is not far from us, abotu an hour and a half away on Interstate 15.


Re: Stump Dirtyninja or others
Link | by hoheshii on 2006-01-22 21:44:06 (edited 2006-01-22 21:45:20)
Everyone is wrong, the official longest word in the english language is:

Methionylglutaminylarginyltyrosylglutamylserylleuclphenylalanyl.....

Well I'm not going to type it all out cuz its 1909 letters long. Its the name of an enzyme consisting of 267 amino acids. It has actually appeared in publications several times.


Now here's another question:

What is the most extracted metallic element?

Wise Man says: "Take a dog off its leash and it will wander."

Re: Stump Dirtyninja or others
Link | by »»Ran on 2006-01-22 22:00:09
This question is not related to longest or largest words.

What is the Philosophical point of view that Plato cannot answer?

Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-23 10:13:26 (edited 2006-01-23 10:34:31)
Rin, doesn't the Thiland city mean some thing like home of the divine palace the most beautiful place on the earth, ect.
I lived in a place called Orbisonia, Pennslyvannia. I can't spell very well, so you can imagine the frustration.

Engineer, to answer your question I have to ask, do you mean overhistory, or in the past few years.
1) over history the most extraced metalic element is iron (no suprise there)
2) In the last few years it was well actually the same iron, is, was and probibly will be, the most extracted element.

Ran, How do we make up our minds, is that what you wanted, he has a few holes in his theories so it's hard to tell what you want.

Try to connect Mad TV to Arizona, or what two Japanese words combine to make carburetor.

Re: Stump Dirtyninja or others
Link | by ROQ sees ya. on 2006-01-23 15:05:09
Mad TV to Arizona:
1.Mad TV is on shown Comedy Central,
2.Comedy Central shows Raising Arizona every once in a while,
3.This movie is about Nicholas Cage and a baby and is set, guess where, in Arizona.

キャブレター means carburetor in Japanese. I check what they are later, too busy right now...

Wow, you can learn some pretty cool stuff here, how useful...


Re: Stump Dirtyninja or others
Link | by hoheshii on 2006-01-23 15:42:25
Ok, here's another one:

What was the first country to make seat belts compulsory?

Wise Man says: "Take a dog off its leash and it will wander."

Re: Stump Dirtyninja or others
Link | by Jomunga on 2006-01-23 15:48:46
I will ask riddles instead of questions. If you already know the answer to the riddle tell me anyways. I'll try to get one for you that you haven't already heard yet.

1st riddle.

What is bigger than a breadbox, smaller than a house,
He who makes it does not use it,
He who buys it does not want it,
He who uses it doesn't technically know he is using it?

Photo Sharing and Video Hosting at PhotobucketJomunga eats your avatars.

Re: Stump Dirtyninja or others
Link | by D-ninja on 2006-01-23 16:14:12
Engineer, Australia. Victoria, Australia to be specific.

Jomunga, is it a 4m tall sponge, no, a plad shirt, no, children, no, an ingagement ring, no, oh well. I've been defeated. Sad part is I used to know this one.

Re: Stump Dirtyninja or others
Link | by hoheshii on 2006-01-23 18:56:24 (edited 2006-01-23 18:57:49)
Actually it was Czekoslovakia in January of 1969.

Now tell me which country consumes the most sugar annually (per capita).

Wise Man says: "Take a dog off its leash and it will wander."

Back | Reverse | Quick Reply | Post Reply |
Go to page: 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, ... 18 Displaying 1 to 20 of 373 Entries.

Copyright 2000-2026 Gendou | Terms of Use | Page loaded in 0.0037 seconds at 2026-07-18 01:18:14